B3galnt2 (NM_178640) Mouse Recombinant Protein

CAT#: TP508122

Purified recombinant protein of Mouse UDP-GalNAc:betaGlcNAc beta 1,3-galactosaminyltransferase, polypeptide 2 (B3galnt2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR208122 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRNWLVLLCPCVLGAALHLWHLWLRSPPDPHNTGPSAADQSALFPHWKFSHYDVVVGVLPARNNHELRNV
  IRNTWLKNLLHHPTLSQRVLVKFIIGARGCEVPVEDREDPYSCRLLNITNPVLNQEIEAFSFPEDASSSR
  LSEDRVVSVSFRVLYPIVITSLGVFYDASDVGFQRNITVKLYQTEQEEALFIARFSPPSCGVQVNKLWYK
  PVEQFILPESFEGTIVWESQDLHGLVSRNLHRVTVNDGGGVLRVLAAGEGALPHEFMEGVEGVAGGFIYT
  VQEGDALLRSLYSRPQRLADHIQDLQVEDALLQEESSVHDDIVFVDVVDTYRNVPAKLLNFYRWTVESTS
  FDLLLKTDDDCYIDLEAVFNRIAQKNLDGPNFWWGNFRLNWAVDRTGKWQELEYPGPAYPAFACGSGYVI
  SKDIVDWLAGNSRRLKTYQGEDVSMGIWMAAIGPKRHQDSLWLCEKTCETGMLSSPQYSPEELSKLWELK
  ELCGDPCQCEAKVR
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 57.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_848755
• Locus ID: 97884
• UniProt ID: Q8BG28
• Cytogenetics: 13 A1
• Refseq Size: 3681
• Refseq ORF: 1515
• Synonyms: A930105D20Rik; C80633; D230016N13Rik
• Summary: Beta-1,3-N-acetylgalactosaminyltransferase that synthesizes a unique carbohydrate structure, GalNAc-beta-1-3GlcNAc, on N- and O-glycans. Has no galactose nor galactosaminyl transferase activity toward any acceptor substrate. Involved in alpha-dystroglycan (DAG1) glycosylation: acts coordinately with GTDC2/POMGnT2 to synthesize a GalNAc-beta3-GlcNAc-beta-terminus at the 4-position of protein O-mannose in the biosynthesis of the phosphorylated O-mannosyl trisaccharide (N-acetylgalactosamine-beta-3-N-acetylglucosamine-beta-4-(phosphate-6-)mannose), a carbohydrate structure present in alpha-dystroglycan, which is required for binding laminin G-like domain-containing extracellular proteins with high affinity (By similarity).[UniProtKB/Swiss-Prot Function]