OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Podxl (NM_013723) Mouse Recombinant Protein

Be the first to review this product
SKU
TP508097
Purified recombinant protein of Mouse podocalyxin-like (Podxl), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Podxl or NM_013723"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR208097 representing NM_013723
Red=Cloning site Green=Tags(s)

MPPTTALSALLLLLLSPASHSHNGNETSTSAIKSSTVQSHQSATTSTEVTTGHPVASTLASTQPSNPTPF
TTSTQSPSMPTSTPNPTSNQSGGNLTSSVSEVDKTKTSSPSSTAFTSSSGQTASSGGKSGDSFTTAPTTT
LGLINVSSQPTDLNTTSKLLSTPTTDNTTSPQQPVDSSPSTASHPVGQHTPAAVPSSSGSTPSTDNSTLT
WKPTTHKPLGTSEATQPLTSQTPGITTLPVSTLQQSMASTVGTTTEEFTHLISNGTPVAPPGPSTPSPIW
AFGNYQLNCEPPIRPDEELLILNLTRASLCERSPLDEKEKLVELLCHSVKASFKPAEDLCTLHVAPILDN
QAVAVKRIIIETKLSPKAVYELLKDRWDDLTEAGVSDMKLGKEGPPEVNEDRFSLPLIITIVCMASFLLL
VAALYGCCHQRISQRKDQQRLTEELQTVENGYHDNPTLEVMETPSEMQEKKVVNLNGELGDSWIVPLDNL
TKDDLDEEEDTHL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 53.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_038751
Locus ID 27205
UniProt ID Q9R0M4
Cytogenetics 6 12.57 cM
RefSeq Size 5330
RefSeq ORF 1509
Synonyms AW121214; Ly102; PC; PCLP-1; Pclp1; Podxl1
Summary Involved in the regulation of both adhesion and cell morphology and cancer progression. Function as an anti-adhesive molecule that maintains an open filtration pathway between neighboring foot processes in the podocyte by charge repulsion. Acts as a pro-adhesive molecule, enhancing the adherence of cells to immobilized ligands, increasing the rate of migration and cell-cell contacts in an integrin-dependent manner. Induces the formation of apical actin-dependent microvilli. Involved in the formation of a preapical plasma membrane subdomain to set up initial epithelial polarization and the apical lumen formation during renal tubulogenesis. Plays a role in cancer development and aggressiveness by inducing cell migration and invasion through its interaction with the actin-binding protein EZR. Affects EZR-dependent signaling events, leading to increased activities of the MAPK and PI3K pathways in cancer cells.UniProtKB/Swiss-Prot Function
Protein Categories Membrane Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products