Podxl (NM_013723) Mouse Recombinant Protein
CAT#: TP508097
Purified recombinant protein of Mouse podocalyxin-like (Podxl), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Podxl"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR208097 representing NM_013723
Red=Cloning site Green=Tags(s) MPPTTALSALLLLLLSPASHSHNGNETSTSAIKSSTVQSHQSATTSTEVTTGHPVASTLASTQPSNPTPF TTSTQSPSMPTSTPNPTSNQSGGNLTSSVSEVDKTKTSSPSSTAFTSSSGQTASSGGKSGDSFTTAPTTT LGLINVSSQPTDLNTTSKLLSTPTTDNTTSPQQPVDSSPSTASHPVGQHTPAAVPSSSGSTPSTDNSTLT WKPTTHKPLGTSEATQPLTSQTPGITTLPVSTLQQSMASTVGTTTEEFTHLISNGTPVAPPGPSTPSPIW AFGNYQLNCEPPIRPDEELLILNLTRASLCERSPLDEKEKLVELLCHSVKASFKPAEDLCTLHVAPILDN QAVAVKRIIIETKLSPKAVYELLKDRWDDLTEAGVSDMKLGKEGPPEVNEDRFSLPLIITIVCMASFLLL VAALYGCCHQRISQRKDQQRLTEELQTVENGYHDNPTLEVMETPSEMQEKKVVNLNGELGDSWIVPLDNL TKDDLDEEEDTHL myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 53.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_038751 |
Locus ID | 27205 |
UniProt ID | Q9R0M4, Q791G4 |
Cytogenetics | 6 12.57 cM |
Refseq Size | 5330 |
Refseq ORF | 1509 |
Synonyms | AW121214; Ly102; PC; PCLP-1; Pclp1; Podxl1 |
Summary | Involved in the regulation of both adhesion and cell morphology and cancer progression. Function as an anti-adhesive molecule that maintains an open filtration pathway between neighboring foot processes in the podocyte by charge repulsion. Acts as a pro-adhesive molecule, enhancing the adherence of cells to immobilized ligands, increasing the rate of migration and cell-cell contacts in an integrin-dependent manner. Induces the formation of apical actin-dependent microvilli. Involved in the formation of a preapical plasma membrane subdomain to set up initial epithelial polarization and the apical lumen formation during renal tubulogenesis. Plays a role in cancer development and aggressiveness by inducing cell migration and invasion through its interaction with the actin-binding protein EZR. Affects EZR-dependent signaling events, leading to increased activities of the MAPK and PI3K pathways in cancer cells.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.