Abat (NM_172961) Mouse Recombinant Protein

CAT#: TP508012

Purified recombinant protein of Mouse 4-aminobutyrate aminotransferase (Abat), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR208012 representing NM_172961
  Red=Cloning site Green=Tags(s)
  
  MAFLLITRRLACSSQKNLHLFIPGSRYISQAAAKVDIEFDYDGPLMKTEVPGPRSKELMKQLNTIQNAEA
  VHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYNHPALAKLVQQPQNASTFINRPALGILPPENFV
  DKLQESLMSVAPRGMSQLITMACGSCSNENAFKTIFMWYRSKERGQRGFSKEELETCMVNQSPGCPDYSI
  LSFMGAFHGRTMGCLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEEFTTDNQQEEARCLEEVEDLIVKY
  RKKKRTVAGIIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPA
  DVMTFSKKMMTGGFFHKEEFRPSAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNVARVGKTLLTGLL
  DLQAQYPQFISRVRGRGTFCSFDTPDEAIRNKLILIARNKGVVLGGCGDKSIRFRPTLVFRDHHAHLFLS
  IFSGILADFK
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 56.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_766549
• Locus ID: 268860
• UniProt ID: P61922
• Cytogenetics: 16 A1
• Refseq Size: 4653
• Refseq ORF: 1500
• Synonyms: 9630038C02Rik; AI255750; GABA; Gabaat; Gabat; Gm9851; I54; Laibat; X61497
• Summary: The encoded gene product is responsible for catabolism of gamma-aminobutyric acid (GABA), a mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde. Deficiency of this encoded protein includes psychomotor retardation, hypotonia, hyperreflexia, lethargy, refractory seizures, and EEG abnormalities. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2010]