Scara5 (NM_028903) Mouse Recombinant Protein

CAT#: TP507870

Purified recombinant protein of Mouse scavenger receptor class A, member 5 (Scara5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR207870 representing NM_028903
  Red=Cloning site Green=Tags(s)
  
  MDNKAMYLHTVSDRDNGSIFEEPFDGRSLSKLNLCEDGPCHKRRAGGCCTQLGSLSALKHAVLGLYLLVF
  LILVGIFILAVSRPRSSPDDLKALTRNVNRLNESLRDMQLRLLQAPLQADLTEQVWKVQDALQNQTDSLL
  ALAGLVQRLEGTLWGLHAQAAQTEQAMALLRDRTGQQSDSAQLELYQLQVESNRSQLLLQRHAGLLDGLA
  RRVGVLGEELADVGGALRGLNHSLSYDVALHSTWLQDLQVLVSNASADTRRMRLVHMDMEMQLKQELATL
  NVVTEDLRLKDWEHSIALRNITLAKGPPGPKGDQGNEGKEGKPGSPGLPGSRGLPGERGDPGLPGPKGDD
  GKLGATGPMGMRGFKGDRGPKGEKGERGERAGDMDFTMIRLVNGSGPHQGRVEVFHDRRWGTVCDDGWDK
  KDGDVVCRMLGFHGVEEVYRTARFGQGTGRIWMDDVNCKGTESSIFHCQFSKWGVTNCGHAEDAGVTCTV
  P
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 54.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_083179
• Locus ID: 71145
• UniProt ID: Q8K299
• Cytogenetics: 14 D1
• Refseq Size: 3809
• Refseq ORF: 1473
• Synonyms: 4932433F15Rik; 4933425F03Rik; AV278087; Tesr
• Summary: Ferritin receptor that mediates non-transferrin-dependent delivery of iron. Mediates cellular uptake of ferritin-bound iron by stimulating ferritin endocytosis from the cell surface with consequent iron delivery within the cell. Delivery of iron to cells by ferritin is required for the development of specific cell types, suggesting the existence of cell type-specific mechanisms of iron traffic in organogenesis, which alternatively utilize transferrin or non-transferrin iron delivery pathways. Ferritin mediates iron uptake in capsule cells of the developing kidney. Binds preferrentially ferritin light chain (FTL) compared to heavy chain (FTH1).[UniProtKB/Swiss-Prot Function]