Camk1g (NM_144817) Mouse Recombinant Protein

CAT#: TP507650

Purified recombinant protein of Mouse calcium/calmodulin-dependent protein kinase I gamma (Camk1g), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR207650 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGRKEEEDCSSWKKQTTNIRKTFIFMEVLGSGAFSEVFLVKQRVTGKLFALKCIKKSPAFRDSSLENEIA
  VLKRIKHENIVTLEDIYESTTHYYLVMQLVSGGELFDRILERGVYTEKDASLVIQQVLSAVKYLHENGIV
  HRDLKPENLLYLTPEENSKIMITDFGLSKMEQNGVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVITY
  ILLCGYPPFYEETESKLFEKIKEGYYEFESPFWDDISESAKDFICHLLEKDPNERYTCEKALRHPWIDGN
  TALHRDIYPSVSLQIQKNFAKSKWRQAFNAAAVVHHMRKLHMNLHSPSVRQEVENRPPVSPAPEVSRPDS
  HDSSITEAPILDPSTPLPALTRLPCSHSSRPSAPSGGRSLNCLVNGSLRISSSLVPMQQGPLATGPCGCC
  SSCLNIGNKGKSSYCSEPTLFRKANKKQNFKSEVMVPVKAGGSTHCRGGQTGVCLVM
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 53.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_659066
• Locus ID: 215303
• UniProt ID: Q91VB2
• Cytogenetics: 1 97.74 cM
• Refseq Size: 2467
• Refseq ORF: 1434
• Synonyms: CaMKIgamma; CLICK-III
• Summary: Calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade. In vitro phosphorylates transcription factor CREB1.[UniProtKB/Swiss-Prot Function]