Ahcy (NM_016661) Mouse Recombinant Protein

CAT#: TP506898

Purified recombinant protein of Mouse S-adenosylhomocysteine hydrolase (Ahcy), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206898 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMREMYSASKPLKGARIAGCLHMTVETAVLIETLVAL
  GAEVRWSSCNIFSTQDHAAAAIAKAGIPVFAWKGETDEEYLWCIEQTLHFKDGPLNMILDDGGDLTNLIH
  TKYPQLLSGIRGISEETTTGVHNLYNMMSNGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVM
  IAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDEACKEGNIFVTTTGCVD
  IILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYWLKNGRRIILLAEGRLVNLGCA
  MGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMP
  INGPFKPDHYRY
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 48.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057870
• Locus ID: 269378
• UniProt ID: P50247, Q3TF14, Q5M9P0
• Cytogenetics: 2 76.94 cM
• Refseq Size: 2560
• Refseq ORF: 1299
• Synonyms: AA987153; AL024110; CuBP; SAHH
• Summary: Adenosylhomocysteine is a competitive inhibitor of S-adenosyl-L-methionine-dependent methyl transferase reactions; therefore adenosylhomocysteinase may play a key role in the control of methylations via regulation of the intracellular concentration of adenosylhomocysteine.[UniProtKB/Swiss-Prot Function]