Fbxl2 (NM_178624) Mouse Recombinant Protein

CAT#: TP506738

Purified recombinant protein of Mouse F-box and leucine-rich repeat protein 2 (Fbxl2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206738 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVFSNSDDGLINKKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRVDLFNFQTDVEGRVVE
  NISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSC
  VSVTNSSLKGISEGCRNLEYLNLSWCDQITKEGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNHCHEL
  VSLNLQSCSRITDDGVVQICRGCHRLQALCLSGCSNLTDASLTALGLNCPRLQVLEAARCSHLTDAGFTL
  LARNCHELEKMDLEECVLITDSTLVQLSIHCPKLQALSLSHCELITDEGILHLSSSTCGHERLRVLELDN
  CLLVTDASLEHLENCRGLERLELYDCQQVTRAGIKRMRAQLPHVKVHAYFAPVTPPPAVAGSGHRLCRCC
  VIL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 46.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_848739
• Locus ID: 72179
• UniProt ID: Q8BH16, Q4VA21
• Cytogenetics: 9 F3
• Refseq Size: 3203
• Refseq ORF: 1272
• Synonyms: 2810423A21Rik; Fbl3
• Summary: Calcium-activated substrate recognition component of the SCF (SKP1-cullin-F-box protein) E3 ubiquitin-protein ligase complex, SCF(FBXL2), which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Unlike many F-box proteins, FBXL2 does not seem to target phosphodegron within its substrates but rather calmodulin-binding motifs and is thereby antagonized by calmodulin. This is the case for the cyclins CCND2 and CCND3 which polyubiquitination and subsequent degradation are inhibited by calmodulin. Through CCND2 and CCND3 degradation induces cell-cycle arrest in G(0). SCF(FBXL2) also mediates PIK3R2 ubiquitination and proteasomal degradation thereby regulating phosphatidylinositol 3-kinase signaling and autophagy (By similarity). PCYT1A monoubiquitination by SCF(FBXL2) and subsequent degradation regulates synthesis of phosphatidylcholine, which is utilized for formation of membranes and of pulmonary surfactant (PubMed:21343341).[UniProtKB/Swiss-Prot Function]