OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Fbxl2 (NM_178624) Mouse Recombinant Protein

Be the first to review this product
SKU
TP506738
Purified recombinant protein of Mouse F-box and leucine-rich repeat protein 2 (Fbxl2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Fbxl2 or NM_178624"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR206738 protein sequence
Red=Cloning site Green=Tags(s)

MVFSNSDDGLINKKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRVDLFNFQTDVEGRVVE
NISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSC
VSVTNSSLKGISEGCRNLEYLNLSWCDQITKEGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNHCHEL
VSLNLQSCSRITDDGVVQICRGCHRLQALCLSGCSNLTDASLTALGLNCPRLQVLEAARCSHLTDAGFTL
LARNCHELEKMDLEECVLITDSTLVQLSIHCPKLQALSLSHCELITDEGILHLSSSTCGHERLRVLELDN
CLLVTDASLEHLENCRGLERLELYDCQQVTRAGIKRMRAQLPHVKVHAYFAPVTPPPAVAGSGHRLCRCC
VIL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 46.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_848739
Locus ID 72179
UniProt ID Q8BH16
Cytogenetics 9 F3
RefSeq Size 3203
RefSeq ORF 1269
Synonyms 2810423A21Rik; Fbl3
Summary Calcium-activated substrate recognition component of the SCF (SKP1-cullin-F-box protein) E3 ubiquitin-protein ligase complex, SCF(FBXL2), which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Unlike many F-box proteins, FBXL2 does not seem to target phosphodegron within its substrates but rather calmodulin-binding motifs and is thereby antagonized by calmodulin. This is the case for the cyclins CCND2 and CCND3 which polyubiquitination and subsequent degradation are inhibited by calmodulin. Through CCND2 and CCND3 degradation induces cell-cycle arrest in G(0). SCF(FBXL2) also mediates PIK3R2 ubiquitination and proteasomal degradation thereby regulating phosphatidylinositol 3-kinase signaling and autophagy (By similarity). PCYT1A monoubiquitination by SCF(FBXL2) and subsequent degradation regulates synthesis of phosphatidylcholine, which is utilized for formation of membranes and of pulmonary surfactant (PubMed:21343341).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products