Bcs1l (NM_025784) Mouse Recombinant Protein

CAT#: TP506614

Purified recombinant protein of Mouse BCS1-like (yeast) (Bcs1l), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206614 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPFSDFVLALKDNPYFGAGFGLVGVGTALAMARKGAQLGLVAFRRHYMITLEVPARDRSYAWLLSWLTRH
  STRTQHLSVETSYLQHESGRISTKFEFIPSPGNHFIWYQGKWIRVERNRDMQMVDLQTGTPWESVTFTAL
  GTDRKVFFNILEEARALALQQEEGKTVMYTAVGSEWRTFGYPRRRRPLDSVVLQQGLADRIVKDIREFID
  NPKWYIDRGIPYRRGYLLYGPPGCGKSSFITALAGELEHSICLLSLTDSSLSDDRLNHLLSVAPQQSLVL
  LEDVDAAFLSRDLAVENPIKYQGLGRLTFSGLLNALDGVASTEARIVFMTTNYIDRLDPALIRPGRVDLK
  EYVGYCSHWQLTQMFQRFYPGQAPSLAENFAEHVLKATSEISPAQVQGYFMLYKNDPMGAVHNIESLR
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 47.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_080060
• Locus ID: 66821
• UniProt ID: Q9CZP5
• Cytogenetics: 1 C3
• Refseq Size: 1829
• Refseq ORF: 1257
• Synonyms: 9130022O19Rik
• Summary: The protein encoded by this gene is a chaperone protein that is involved in the assembly of complex III (CIII), one of the five protein complexes of the mitochondrial respiratory chain, and is necessary for the insertion of the Rieske iron-sulfur (RISP) and Qcr10p proteins into the precomplex. Studies from the yeast ortholog of this protein indicate that it is targeted to the inner membrane of the mitochondria, despite the absence of an N-terminal targeting sequence. Positively charged amino acids located C-terminal to the transmembrane domain are thought to act as an internal targeting signal (PMID:8599931). Mutations in the human ortholog of this gene have been associated with GRACILE syndrome, characterized by Growth retardation, Amino aciduria, Cholestasis, Iron overload, Lactic acidosis, and Early death. Mouse models with the corresponding mutation mimic the phenotype of GRACILE syndrome and display decreased complex III activity and decreased electron transport capacity (PMID:21274865). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2015]