Trib1 (NM_144549) Mouse Recombinant Protein
CAT#: TP505755
Purified recombinant protein of Mouse tribbles pseudokinase 1 (Trib1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (2)
Other products for "Trib1"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR205755 protein sequence
Red=Cloning site Green=Tags(s) MRVGPVRFALSGASQPRGPGLLFPAARGTPAKRLLDTDDAGAVAAKCPRLSECSSPPDYLSPPGSPCSPQ PPPSTQGTGGSCVSSPGPSRIADYLLLPLAEREHVSRALCIHTGRELRCKEFPIKHYQDKIRPYIQLPSH SNITGIVEVLLGESKAYVFFEKDFGDMHSYVRSRKRLREEEAARLFKQIVSAVAHCHQSAIVLGDLKLRK FVFSTEERTQLRLESLEDTHIIKGEDDALSDKHGCPAYVSPEILNTTGTYSGKAADVWSLGVMLYTLLVG RYPFHDSDPSALFSKIRRGQFCIPEHVSPKARCLIRSLLRREPSERLTAPQILLHPWFEYVLEPGYVDSE IGTSDQIVPEYQEDSDISSFFC myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 41.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_653132 |
Locus ID | 211770 |
UniProt ID | Q8K4K4 |
Cytogenetics | 15 D1 |
Refseq Size | 4026 |
Refseq ORF | 1119 |
Synonyms | A530090O15Rik; TRB-1; Trb1 |
Summary | Adapter protein involved in protein degradation by interacting with COP1 ubiquitin ligase (PubMed:23515163, PubMed:20410507). Promotes CEBPA degradation and inhibits its function (PubMed:20410507). Controls macrophage, eosinophil and neutrophil differentiation via the COP1-binding domain (PubMed:24003916, PubMed:23515163). Regulates myeloid cell differentiation by altering the expression of CEBPA in a COP1-dependent manner (PubMed:23515163). Interacts with MAPK kinases and regulates activation of MAP kinases, but has no kinase activity (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.