Sgk2 (NM_013731) Mouse Recombinant Protein

CAT#: TP505649

Purified recombinant protein of Mouse serum/glucocorticoid regulated kinase 2 (Sgk2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205649 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASSPVGVPSPQPSRANGNINLGPSANPNARPTDFDFLKVIGKGNYGKVLLAKRKSDGAFYAVKVLQKKS
  ILKNKENHIMAERNVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGELFFHLQRERRFLEPRARFYTA
  EVASAIGYLHSLNIIYRDLKPENILLDCQGHVVLTDFGLCKECVEPEETTSTFCGTPEYLAPEVLRKEPY
  DRAVDWWCLGAVLYEMLHGLPPFFNTDVAQMYENILHQPLQIPGGRTVAACDLLQGLLHKDQRQRLGSKE
  DFLDIKNHMFFSPINWDDLYHKRLTPPFNPNVEGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSA
  FLGFSYAQDDDDILDS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 41.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_038759
• Locus ID: 27219
• UniProt ID: Q9QZS5, Q3UW73
• Cytogenetics: 2 H2
• Refseq Size: 2554
• Refseq ORF: 1101
• Synonyms: AI098171; AW146006; Sgkl
• Summary: Serine/threonine-protein kinase which is involved in the regulation of a wide variety of ion channels, membrane transporters, cell growth, survival and proliferation. Up-regulates Na(+) channels: SCNN1A/ENAC, K(+) channels: KCNA3/Kv1.3, KCNE1 and KCNQ1, amino acid transporter: SLC6A19, glutamate transporter: SLC1A6/EAAT4, glutamate receptors: GRIA1/GLUR1 and GRIK2/GLUR6, Na(+)/H(+) exchanger: SLC9A3/NHE3, and the Na(+)/K(+) ATPase.[UniProtKB/Swiss-Prot Function]