Eif2b2 (NM_145445) Mouse Recombinant Protein

CAT#: TP505324

Purified recombinant protein of Mouse eukaryotic translation initiation factor 2B, subunit 2 beta (Eif2b2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205324 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPGAAAKGSELSERIEGFVETLKRGGGQRSSEDMARETLGLLRRLITDHHWNNAGDLMDLIRREGRRMTA
  AQPSETTVGNMVRRVLKIIREEYGRLHGRSDESDQQESLHKLLTSGGLSEDFSFHFAPLKANIIEAINEL
  LVELEGTMENIAAQALEHIHSNEVIMTIGYSRTVEAFLKEAARKRKFHVIVAECAPFCQGHEMAVNLSKE
  GIETTVMTDAAIFAVMSRVNKVIIGTKTILANGSLRAVAGTHTLALAAKHHSTPLIVCAPMFKLSPQFPS
  EEDSFHKFVAPEEVLPFTEGDILEKVSVHCPVFDYVPPDLITLFISNIGGNAPSYIYRLMSELYHPDDHV
  L
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 38.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_663420
• Locus ID: 217715
• UniProt ID: Q99LD9
• Cytogenetics: 12 D1
• Refseq Size: 1573
• Refseq ORF: 1056
• Synonyms: EIF-2Bbe; EIF-2Bbeta; EIF2; EIF2B
• Summary: This gene encodes the beta subunit of eukaryotic initiation factor-2B (EIF2B). EIF2B is involved in protein synthesis and exchanges GDP and GTP for its activation and deactivation. Mutations in the human gene are associated with ovarioleukodystrophy and leukoencephalopathy with vanishing white matter. [provided by RefSeq, Sep 2015]