Dcps (NM_027030) Mouse Recombinant Protein
CAT#: TP505053
Purified recombinant protein of Mouse decapping enzyme, scavenger (Dcps), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Dcps"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR205053 protein sequence
Red=Cloning site Green=Tags(s) MADTAPQLKRKREQEAEEAETPSTEEKEAGVGNGTSAPVRLPFSGFRVQKVLRESARDKIIFLHGKVNED SGDTHGEDAVVILEKTPFQVEHVAQLLTGSPELKLQFSNDIYSTYNLFPPRHLSDIKTTVVYPATEKHLQ KYMRQDLRLIRETGDDYRTITLPYLESQSLSIQWVYNILDKKAEADRIVFENPDPSDGFVLIPDLKWNQQ QLDDLYLIAICHRRGIRSLRDLTPEHLPLLRNILREGQEAILKRYQVTGDRLRVYLHYLPSYYHLHVHFT ALGFEAPGSGVERAHLLAQVIENLECDPKHYQQRTLTFALRTDDPLLQLLQKAQQERN myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 39 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_081306 |
Locus ID | 69305 |
UniProt ID | Q9DAR7 |
Cytogenetics | 9 A4 |
Refseq Size | 1194 |
Refseq ORF | 1017 |
Synonyms | 1700001E16Rik; AA408441 |
Summary | Decapping scavenger enzyme that catalyzes the cleavage of a residual cap structure following the degradation of mRNAs by the 3'->5' exosome-mediated mRNA decay pathway. Hydrolyzes cap analog structures like 7-methylguanosine nucleoside triphosphate (m7GpppG) with up to 10 nucleotide substrates (small capped oligoribonucleotides) and specifically releases 5'-phosphorylated RNA fragments and 7-methylguanosine monophosphate (m7GMP). Cleaves cap analog structures like tri-methyl guanosine nucleoside triphosphate (m3(2,2,7)GpppG) with very poor efficiency. Does not hydrolyze unmethylated cap analog (GpppG) and shows no decapping activity on intact m7GpppG-capped mRNA molecules longer than 25 nucleotides. Does not hydrolyze 7-methylguanosine diphosphate (m7GDP) to m7GMP. May also play a role in the 5'->3 mRNA decay pathway; m7GDP, the downstream product released by the 5'->3' mRNA mediated decapping activity, may be also converted by DCPS to m7GMP. Binds to m7GpppG and strongly to m7GDP. Plays a role in first intron splicing of pre-mRNAs. Inhibits activation-induced cell death.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.