Sfxn3 (NM_053197) Mouse Recombinant Protein

CAT#: TP504636

Purified recombinant protein of Mouse sideroflexin 3 (Sfxn3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug


USD 988.00

4 Weeks*

Size
    • 20 ug

Product Images

Frequently bought together (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "Sfxn3"

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204636 protein sequence
Red=Cloning site Green=Tags(s)

MGDLPLNINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGEQLEASRNIVQNYRAGVATPGLTEDQLWRA
KYVYDSAFHPDTGEKVVLIGRMSAQVPMNMTITGCMLTFYRKTPTVVFWQWVNQSFNAIVNYSNRSGDAP
ITVQQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAANCINIPLMRQRELQVGIPVTDEA
GQRLGHSVTAAKQGIFQVVISRIGMAIPAMAIPPVIMNTLEKKDFLKRRPWLGAPLQVGLVGFCLVFATP
LCCALFPQRSSIHVTRLEPELRAQIQAQNPSIDVVYYNKGL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 35.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_444427
Locus ID 94280
UniProt ID Q91V61
Cytogenetics 19 C3
Refseq Size 2974
Refseq ORF 966
Summary Mitochondrial serine transporter that mediates transport of serine into mitochondria, an important step of the one-carbon metabolism pathway. Mitochondrial serine is converted to glycine and formate, which then exits to the cytosol where it is used to generate the charged folates that serve as one-carbon donors.[UniProtKB/Swiss-Prot Function]

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.