Mlx (NM_011550) Mouse Recombinant Protein
CAT#: TP504137
Purified recombinant protein of Mouse MAX-like protein X (Mlx), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Mlx"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR204137 protein sequence
Red=Cloning site Green=Tags(s) MTEPGASPEDPWVKASFADAHAGEGRAGRARARRGSGRRGAPQLSPESPLLSGARGCREDSSHPACAKVE YAYSDNSLDPGLFVESTHKGSVVSRANSIGSTSASSVPNTDEEDSDYQQESYKESYKDRRRRAHTQAEQK RRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKI MKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCEPQ TLREIVIGVLHQLKNQLY myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 33.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_035680 |
Locus ID | 21428 |
UniProt ID | O08609, A2BFB0, Q3UQB4 |
Cytogenetics | 11 D |
Refseq Size | 1992 |
Refseq ORF | 897 |
Synonyms | bHLHd13; Tcfl4; Tf4 |
Summary | Transcription regulator. Forms a sequence-specific DNA-binding protein complex with MAD1, MAD4, MNT, WBSCR14 and MLXIP which recognizes the core sequence 5'-CACGTG-3'. The TCFL4-MAD1, TCFL4-MAD4, TCFL4-WBSCR14 complexes are transcriptional repressors. Plays a role in transcriptional activation of glycolytic target genes. Involved in glucose-responsive gene regulation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.