Mlx (NM_011550) Mouse Recombinant Protein

CAT#: TP504137

Purified recombinant protein of Mouse MAX-like protein X (Mlx), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR204137 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTEPGASPEDPWVKASFADAHAGEGRAGRARARRGSGRRGAPQLSPESPLLSGARGCREDSSHPACAKVE
  YAYSDNSLDPGLFVESTHKGSVVSRANSIGSTSASSVPNTDEEDSDYQQESYKESYKDRRRRAHTQAEQK
  RRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKI
  MKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCEPQ
  TLREIVIGVLHQLKNQLY
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 33.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_035680
• Locus ID: 21428
• UniProt ID: O08609, A2BFB0, Q3UQB4
• Cytogenetics: 11 D
• Refseq Size: 1992
• Refseq ORF: 897
• Synonyms: bHLHd13; Tcfl4; Tf4
• Summary: Transcription regulator. Forms a sequence-specific DNA-binding protein complex with MAD1, MAD4, MNT, WBSCR14 and MLXIP which recognizes the core sequence 5'-CACGTG-3'. The TCFL4-MAD1, TCFL4-MAD4, TCFL4-WBSCR14 complexes are transcriptional repressors. Plays a role in transcriptional activation of glycolytic target genes. Involved in glucose-responsive gene regulation.[UniProtKB/Swiss-Prot Function]