Fbxo2 (NM_176848) Mouse Recombinant Protein
CAT#: TP504114
Purified recombinant protein of Mouse F-box protein 2 (Fbxo2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Frequently bought together (2)
Other products for "Fbxo2"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR204114 protein sequence
Red=Cloning site Green=Tags(s) MDGDGDPESVSHPEEASPEEQPEEAGAEASAEEEQLREAEEEEEAEAVEYLAELPEPLLLRVLAELPATE LVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGSADEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGW SDVEHGGDGWRVEELPGDNGVEFTQDDSVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDW YSGRTDAGSLYELTVRLLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYW KGWFGARVTNSSVWVEP myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 33.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_789818 |
Locus ID | 230904 |
UniProt ID | Q80UW2, Q3USR5 |
Cytogenetics | 4 78.68 cM |
Refseq Size | 1260 |
Refseq ORF | 894 |
Synonyms | FBG1; Fbs1; Fbs2; FBX2; NFB42; Prpl4 |
Summary | Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex that mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Involved in the endoplasmic reticulum-associated degradation pathway (ERAD) for misfolded lumenal proteins by recognizing and binding sugar chains on unfolded glycoproteins that are retrotranslocated into the cytosol and promoting their ubiquitination and subsequent degradation. Prevents formation of cytosolic aggregates of unfolded glycoproteins that have been retrotranslocated into the cytosol. Able to recognize and bind denatured glycoproteins, preferentially those of the high-mannose type.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.