Fbxo2 (NM_176848) Mouse Recombinant Protein

CAT#: TP504114

Purified recombinant protein of Mouse F-box protein 2 (Fbxo2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein Fbxo2 was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR204114 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDGDGDPESVSHPEEASPEEQPEEAGAEASAEEEQLREAEEEEEAEAVEYLAELPEPLLLRVLAELPATE
  LVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGSADEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGW
  SDVEHGGDGWRVEELPGDNGVEFTQDDSVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDW
  YSGRTDAGSLYELTVRLLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYW
  KGWFGARVTNSSVWVEP
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 33.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_789818
• Locus ID: 230904
• UniProt ID: Q80UW2, Q3USR5
• Cytogenetics: 4 78.68 cM
• Refseq Size: 1260
• Refseq ORF: 894
• Synonyms: FBG1; Fbs1; Fbs2; FBX2; NFB42; Prpl4
• Summary: Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex that mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Involved in the endoplasmic reticulum-associated degradation pathway (ERAD) for misfolded lumenal proteins by recognizing and binding sugar chains on unfolded glycoproteins that are retrotranslocated into the cytosol and promoting their ubiquitination and subsequent degradation. Prevents formation of cytosolic aggregates of unfolded glycoproteins that have been retrotranslocated into the cytosol. Able to recognize and bind denatured glycoproteins, preferentially those of the high-mannose type.[UniProtKB/Swiss-Prot Function]