Ssr1 (NM_025965) Mouse Recombinant Protein

CAT#: TP503901

Purified recombinant protein of Mouse signal sequence receptor, alpha (Ssr1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203901 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRLLPRLLLLFLLAFPAAVLLRGGPGGSLALAQDPTEDEEIVEDSIIEDEDDEAEVEEDEPTDLAEDKEE
  EDVSSEPEASPSADTTILFVKGEDFPANNIVKFLVGFTNKGTEDFIVESLDASFRYPQDYQFYIQNFTAL
  PLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIEREDGLDGETIFM
  YMFLAGLGLLVVVGLHQLLESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRQPRKRAQKR
  SVGSDE
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 32.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_080241
• Locus ID: 107513
• UniProt ID: Q9CY50
• Cytogenetics: 13 A3.3
• Refseq Size: 9306
• Refseq ORF: 861
• Synonyms: 2510001K09Rik; 6330400D04; AI159733; AI452176; SSR; TRAPA
• Summary: TRAP proteins are part of a complex whose function is to bind calcium to the ER membrane and thereby regulate the retention of ER resident proteins. May be involved in the recycling of the translocation apparatus after completion of the translocation process or may function as a membrane-bound chaperone facilitating folding of translocated proteins.[UniProtKB/Swiss-Prot Function]