Fbxo27 (NM_001163702) Mouse Recombinant Protein

CAT#: TP503765

Purified recombinant protein of Mouse F-box protein 27 (Fbxo27), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203765 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGAWISRTRVPTPEPDPQEVLDLSRLPPELLLLVLSHVPPRTLLMHCRRVCRAWRALVDGQALWLLLLAR
  DHSAAGRALLTLARRCLPPAHEDTPCPLGQFCALRPLGRNLISNPCGQEGLRKWMVRHGGDGWVVEKNRK
  PVPGAPSQTCFVTSFSWCRKKQVVDLVEKGLWPELLDSGGVEIAVSDWWGARHDSGCKYRLFVTLLDAHQ
  NVIDKFSAVPDPIEQWNNDIYLQVTHVFSGIRRGIRFVSFEHWGQDTQFWAGHYGARVTNSSVIIRVCQS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 31.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001157174
• Locus ID: 233040
• UniProt ID: Q6DIA9
• Cytogenetics: 7 B1
• Refseq Size: 1966
• Refseq ORF: 843
• Synonyms: E130008B10Rik; FBG5; Gm161
• Summary: Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Able to recognize and bind complex-type oligosaccharides.[UniProtKB/Swiss-Prot Function]