Icam2 (NM_010494) Mouse Recombinant Protein

CAT#: TP503730

Purified recombinant protein of Mouse intercellular adhesion molecule 2 (Icam2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203730 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSFACWSLSLLILFYSPGSGEKAFEVYIWSEKQIVEATESWKINCSTNCAAPDMGGLETPTNKIMLEEH
  PQGKWKQFLVSNVSKDTVFFCHFTCSGKQHSESLNIRVYQPPAQVTLKLQPPRVFVGEDFTIECTVSPVQ
  PLERLTLSLLRGRETLKNQTFGGAETVPQEATATFNSTALKKDGLNFSCQAELDLRPHGGYIIRSISEYQ
  ILEVYEPMQDNQMVIIIVVVSILLFLFVTSVLLCFIFGQHWHRRRTGTYGVLAAWRRLPRAFRARPV
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 31.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_034624
• Locus ID: 15896
• UniProt ID: P35330
• Cytogenetics: 11 69.09 cM
• Refseq Size: 1168
• Refseq ORF: 834
• Synonyms: CD102; Icam-2; Ly-60
• Summary: ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). ICAM2 may play a role in lymphocyte recirculation by blocking LFA-1-dependent cell adhesion. It mediates adhesive interactions important for antigen-specific immune response, NK-cell mediated clearance, lymphocyte recirculation, and other cellular interactions important for immune response and surveillance.[UniProtKB/Swiss-Prot Function]