Arl14ep (NM_001025102) Mouse Recombinant Protein

CAT#: TP503711

Purified recombinant protein of Mouse ADP-ribosylation factor-like 14 effector protein (Arl14ep), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203711 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDPCSVGVQLRTTHDCHKTFYTRHTGFKTLKELSSNDMLLLQLRTGMTLSGNNTICLHHVKIYIDRFEDL
  RKSCCDPFNIHKKLAKKNLHVIDLDDATFLSAKFGRQLVPGWKLCPKCTQIINGSVDVDSDDRQRRKPDS
  DGRTAKALRSLQFTNPGKQTEFAPEGGKREKRKLTKATSAASDRQIIPAKSKVYDSQGLLIFSGMDLCDC
  LDEDCLGCFYACPTCGSTKCGAECRCDRKWLYEQIEIEGGEIIHNKHAGKAYGLLSPCHPYDILQK
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 31 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001020273
• Locus ID: 212772
• UniProt ID: Q8BIX3
• Cytogenetics: 2 E3
• Refseq Size: 3309
• Refseq ORF: 831
• Synonyms: 2700007P21Rik; 4930448O08Rik; ARF7EP
• Summary: Through its interaction with ARL14 and MYO1E, may connect MHC class II-containing cytoplasmic vesicles to the actin network and hence controls the movement of these vesicles along the actin cytoskeleton in dendritic cells.[UniProtKB/Swiss-Prot Function]