Mitd1 (NM_026913) Mouse Recombinant Protein
CAT#: TP503167
Purified recombinant protein of Mouse MIT, microtubule interacting and transport, domain containing 1 (Mitd1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Mitd1"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203167 protein sequence
Red=Cloning site Green=Tags(s) MAKSSLGQDSDSTAAVAVLKRAVELDAESRYQQALVCYQEGIDMLLQVLKGTKESSKRCVLRTKISGYMD RAENIKKYLDQEKEDGKYHKQIKIEENATGFSYESLFREYLHETVTEVWIEDPYIRQTHQLYNFLRFCEM LIKKPCKVRTIHLLTSGYEGLGNTQQSSGLEEIKQSLGSHGVVLEINYSSSIHDREIRFNNGWMIKIGRG LDYFKKPQGRFSLGYYDLDLRPCHETTVDIFHNKHTKKI myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 28.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_081189 |
Locus ID | 69028 |
UniProt ID | Q8VDV8 |
Cytogenetics | 1 B |
Refseq Size | 1229 |
Refseq ORF | 750 |
Synonyms | 1500032H18Rik |
Summary | Required for efficient abscission at the end of cytokinesis, together with components of the ESCRT-III complex.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.