OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Mog (NM_010814) Mouse Recombinant Protein

Be the first to review this product
SKU
TP503093
Purified recombinant protein of Mouse myelin oligodendrocyte glycoprotein (Mog), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Mog or NM_010814"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR203093 protein sequence
Red=Cloning site Green=Tags(s)

MACLWSFSLPSCFLSLLLLLLLQLSCSYAGQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYR
SPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAM
ELKVEDPFYWVNPGVLTLIALVPTILLQVSVGLVFLFLQHRLRGKLRAEVENLHRTFDPHFLRVPCWKIT
LFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 28.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_034944
Locus ID 17441
UniProt ID Q61885
Cytogenetics 17 19.16 cM
RefSeq Size 1725
RefSeq ORF 741
Synonyms B230317G11Rik
Summary Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication. Mediates homophilic cell-cell adhesion.UniProtKB/Swiss-Prot Function
Protein Categories Cytokines, Membrane Proteins, Nervous system Diseases
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

A reliable Western blot workflow with improved dynamic range for the detection of myelin proteins in murine brain
Liu, Lakhani, Furber
Biochem Cell Biol (2025) 103, 1-13 DOI: 10.1139/bcb-2025-0093
AI Summary: OriGene contributed to this study by providing the full-length recombinant mouse MOG protein (#TP503093), which was used as a standard to optimize and validate the improved Western blot workflow for detecting myelin proteins in murine brain.
Snippet: The color pre-stained protein standard (#P7712) was purchased from New England Biolabs. Full-length recombinant mouse MOG protein (#TP503093) was purchased from Origene. Bovine serum albumin (BSA;#A9647) was purchased from Sigma–Aldrich. Methanol (#C20903.550) was purchased from VWR
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products