Nudt18 (BC036718) Mouse Recombinant Protein
CAT#: TP503089
Purified recombinant protein of Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 18 (cDNA clone MGC:38179 IMAGE:5322150), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Nudt18"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203089 protein sequence
Red=Cloning site Green=Tags(s) MEPGETIVEAMQREVKEEAGLLCEPVTLLSVEERGASWIRFVFLARPTGGVLKTSKDADSESLQAGWYPR VSLPTPLRAHDVLHLVELGAKFCQQAMHPLILPQELPCSVVCQRLVTTFTTVQSVWVLVGTVGTPHLPIT ACGFTPMEQRGGIKVAILRLLQECLTLHSLAVETKGLLGLQHLGRDHVDGVCLNVLVTVAFRNPGIQDEP PKIRGENYFWWKVLEEDLQKLLLYRLQESSVIPLSR myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 27.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 213484 |
UniProt ID | Q3U2V3 |
Cytogenetics | 14 D2 |
Refseq Size | 1630 |
Refseq ORF | 738 |
Synonyms | MGC38179 |
Summary | Mediates the hydrolyzis of oxidized nucleoside diphosphate derivatives. Hydrolyzes 8-oxo-7,8-dihydroguanine (8-oxo-Gua)-containing deoxyribo- and ribonucleoside diphosphates to the monophosphates. Hydrolyzes 8-oxo-dGDP and 8-oxo-GDP with the same efficiencies. Hydrolyzes also 8-OH-dADP and 2-OH-dADP. Exhibited no or minimal hydrolyzis activity against 8-oxo-dGTP, 8-oxo-GTP, dGTP, GTP, dGDP and GDP. Probably removes oxidized guanine nucleotides from both the DNA and RNA precursor pools (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.