Mbl2 (NM_010776) Mouse Recombinant Protein

CAT#: TP503052

Purified recombinant protein of Mouse mannose-binding lectin (protein C) 2 (Mbl2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203052 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSIFTSFLLLCVVTVVYAETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPG
  KVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVK
  KMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPN
  NTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 26 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_034906
• Locus ID: 17195
• UniProt ID: P41317, Q3UEK1
• Cytogenetics: 19 25.14 cM
• Refseq Size: 1069
• Refseq ORF: 735
• Synonyms: L-MBP; MBL; MBL-C; MBP-C
• Summary: Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages (By similarity).[UniProtKB/Swiss-Prot Function]