Slc50a1 (NM_009057) Mouse Recombinant Protein
CAT#: TP502536
Purified recombinant protein of Mouse solute carrier family 50 (sugar transporter), member 1 (Slc50a1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Slc50a1"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202536 protein sequence
Red=Cloning site Green=Tags(s) MEAGGVADSFLSSACVLFTLGMFSTGLSDLRHMQRTRSVDNIQFLPFLTTDVNNLSWLSYGVLKGDGTLI IVNSVGAVLQTLYILAYLHYSPQKHGVLLQTATLLAVLLLGYGYFWLLVPDLEARLQQLGLFCSVFTISM YLSPLADLAKIVQTKSTQRLSFSLTIATLFCSASWSIYGFRLRDPYITVPNLPGILTSLIRLGLFCKYPP EQDRKYRLLQT myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 24.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_033083 |
Locus ID | 19729 |
UniProt ID | Q9CXK4 |
Cytogenetics | 3 39.04 cM |
Refseq Size | 1031 |
Refseq ORF | 666 |
Synonyms | MmSWEET1; Rag1ap1; Rga |
Summary | Mediates sugar transport across membranes (By similarity). May regulate the expression of RAG1 a gene involved in V(D)J recombination.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.