Snx10 (NM_001127349) Mouse Recombinant Protein

CAT#: TP502067

Purified recombinant protein of Mouse sorting nexin 10 (Snx10), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202067 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFPEQQKEEFVSVWVRDPRIQKEDFWHSYIDYEICIHTNSMCFTMKTSCVRRRYREFVWLRQRLQSNALL
  VQLPELPSKNLFFNMNNRQHVDQRRQGLEDFLRKVLQNALLLSDSSLHLFLQSHLNSEDIEACVSGQTKY
  SVEEAIHKFALMNRRFPEEEEEGKKDADVEYDSESSSSGLGHSSDDSSSHGCKTSPALQES
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Tag: C-MYC/DDK
• Predicted MW: 23.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001120821
• Locus ID: 71982
• UniProt ID: Q9CWT3, Q4FJX6, Q3UBN7
• Cytogenetics: 6 B3
• Refseq Size: 2469
• Refseq ORF: 606
• Synonyms: 2410004M09Rik
• Summary: Probable phosphoinositide-binding protein involved in protein sorting and membrane trafficking in endosomes. Plays a role in cilium biogenesis through regulation of the transport and the localization of proteins to the cilium. Required for the localization to the cilium of V-ATPase subunit ATP6V1D and ATP6V0D1, and RAB8A. Involved in osteoclast differentiation and therefore bone resorption.[UniProtKB/Swiss-Prot Function]