Tspo (NM_009775) Mouse Recombinant Protein

CAT#: TP501408

Purified recombinant protein of Mouse translocator protein (Tspo), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Coomassie blue staining of purified Tspo protein (Cat# TP501408). The protein was produced from HEK293T cells transfected with Tspo cDNA clone (Cat# MR201408) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201408 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYAGLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKE
  LGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPY
  LAWLAFATVLNYYVWRDNSGRRGGSRLAE
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 18.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_033905
• Locus ID: 12257
• UniProt ID: P50637
• Cytogenetics: 15 39.4 cM
• Refseq Size: 871
• Refseq ORF: 510
• Synonyms: Bzrp; IBP; PBR; Tspo1
• Summary: Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme (By similarity). Was initially identified as peripheral-type benzodiazepine receptor; can also bind isoquinoline carboxamides. Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism (PubMed:9832438, PubMed:24814875), but its precise physiological role is controversial. According to some reports, it is not required for steroid hormone biosynthesis (PubMed:24174323, PubMed:24936060).[UniProtKB/Swiss-Prot Function]