Srek1ip1 (NM_026075) Mouse Recombinant Protein
CAT#: TP501116
Purified recombinant protein of Mouse splicing regulatory glutamine/lysine-rich protein 1interacting protein 1 (Srek1ip1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Srek1ip1"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201116 protein sequence
Red=Cloning site Green=Tags(s) MAVPGCNKDNVRAGCRKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNKLQALQEKRI NEEEEKKKEKSREKIKLKKRRKRSYSSATEEDSAKQKKQKYQKKEKKKEKKNKSKKGKHHKKEKKKRKKE KRSSPYHSELTKK myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 18.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_080351 |
Locus ID | 67288 |
UniProt ID | Q4V9W2 |
Cytogenetics | 13 D1 |
Refseq Size | 1715 |
Refseq ORF | 462 |
Synonyms | 3110031B13Rik; AI462702; AV348305; AW121048; Sfrs12ip1; Srsf12ip1 |
Summary | Possible splicing regulator involved in the control of cellular survival.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.