Ssbp1 (NM_212468) Mouse Recombinant Protein

CAT#: TP501027

Purified recombinant protein of Mouse single-stranded DNA binding protein 1 (Ssbp1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201027 representing NM_212468
  Red=Cloning site Green=Tags(s)
  
  MFRRPVLQVFRQFVRHESEVASSLVLERSLNRVQLLGRVGQDPVMRQVEGKNPVTIFSLATNEMWRSGDS
  EVYQMGDVSQKTTWHRISVFRPGLRDVAYQYVKKGARIFVEGKVDYGEYMDKNNVRRQATTIIADNIIFL
  SDQTKEKA
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 17.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_997633
• Locus ID: 381760
• UniProt ID: Q9CYR0, Q8R2K3
• Cytogenetics: 6 B1
• Refseq Size: 1489
• Refseq ORF: 444
• Synonyms: 2810480P10Rik; G630031O20Rik; mtDBP; MtSSB
• Summary: This protein binds preferentially and cooperatively to ss-DNA. Probably involved in mitochondrial DNA replication. Associates with mitochondrial DNA (By similarity).[UniProtKB/Swiss-Prot Function]