Trfp (BC060122) Mouse Recombinant Protein
CAT#: TP500965
Purified recombinant protein of Mouse Trf (TATA binding protein-related factor)-proximal protein homolog (Drosophila) (cDNA clone MGC:63299, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Trfp"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200965 protein sequence
Red=Cloning site Green=Tags(s) MGVTCVSQMPVAEGKSLQQTVELLTKKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQAGKLMYVMHNSE YPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISV EVRPW myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 15.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 56771 |
UniProt ID | Q9R0X0 |
Cytogenetics | 17 C |
Refseq Size | 5774 |
Refseq ORF | 435 |
Synonyms | 1110011O05Rik; 2410115I17Rik; AU018348; Trfp |
Summary | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.