Trfp (BC060122) Mouse Recombinant Protein

CAT#: TP500965

Purified recombinant protein of Mouse Trf (TATA binding protein-related factor)-proximal protein homolog (Drosophila) (cDNA clone MGC:63299, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200965 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGVTCVSQMPVAEGKSLQQTVELLTKKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQAGKLMYVMHNSE
  YPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISV
  EVRPW
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 15.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• Locus ID: 56771
• UniProt ID: Q9R0X0
• Cytogenetics: 17 C
• Refseq Size: 5774
• Refseq ORF: 435
• Synonyms: 1110011O05Rik; 2410115I17Rik; AU018348; Trfp
• Summary: Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).[UniProtKB/Swiss-Prot Function]