Phlda2 (NM_009434) Mouse Recombinant Protein

CAT#: TP500950

Purified recombinant protein of Mouse pleckstrin homology like domain, family A, member 2 (Phlda2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200950 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASKIVMSSKTVKTSDEILCEGELEKRSDSLFQVWKKKRCVLTADRLRLFSGKTSPAKELFFHSILKVDC
  VEHTSKYVYFTIVTNYYKEIDFRCTVESCWNAAITMALIDFQNRRALQDFPRYRYQRSESEMPSEPGEQS
  ALGP
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 16.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_033460
• Locus ID: 22113
• UniProt ID: O08969
• Cytogenetics: 7 88.23 cM
• Refseq Size: 737
• Refseq ORF: 435
• Synonyms: Ipl; Tss; Tssc3
• Summary: This gene is one of several genes in the imprinted gene domain on chromosome 7. Studies using knockout mice have shown that the product of this gene regulates placental growth. Transcripts from this gene are most abundant in placenta and yolk sac, and are almost entirely transcribed from the maternal allele. [provided by RefSeq, Jul 2008]