Sub1 (NM_011294) Mouse Recombinant Protein

CAT#: TP500688

Purified recombinant protein of Mouse SUB1 homolog, transcriptional regulator (Sub1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200688 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPKSKELVSSSSSGSDSDSEVEKKLKRKKQAVPEKPVKKQKPGETSRALASSKQSSSSRDDNMFQIGKMR
  YVSVRDFKGKILIDIREYWMDSEGEMKPGRKGISLNMEQWSQLKEQISDIDDAVRKL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 14.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_035424
• Locus ID: 20024
• UniProt ID: P11031
• Cytogenetics: 15 A1
• Refseq Size: 3321
• Refseq ORF: 384
• Synonyms: AI842364; P9; P15; Pc4; Rpo2tc1
• Summary: General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds single-stranded DNA. Also binds, in vitro, non-specifically to double-stranded DNA (ds DNA).[UniProtKB/Swiss-Prot Function]