Srp14 (NM_009273) Mouse Recombinant Protein

CAT#: TP500415

Purified recombinant protein of Mouse signal recognition particle 14 (Srp14), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200415 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVLLESEQFLTELTRLFQKCRSSGSVFITLKKYDGRTKPIPRKSSVEGLEPAENKCLLRATDGKRKISTV
  VSSKEVNKFQMAYSNLLRANMDGLKKRDKKNKSKKSKPAQ
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 12.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_033299
• Locus ID: 20813
• UniProt ID: P16254
• Cytogenetics: 2 E5
• Refseq Size: 790
• Refseq ORF: 333
• Synonyms: 14kDa; AW536328
• Summary: Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding.[UniProtKB/Swiss-Prot Function]