RhoGDI (ARHGDIA) (NM_001185078) Human Recombinant Protein
CAT#: TP331004
Purified recombinant protein of Homo sapiens Rho GDP dissociation inhibitor (GDI) alpha (ARHGDIA), transcript variant 3, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC231004 representing NM_001185078
Red=Cloning site Green=Tags(s) MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNV VVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKND DKTDHLSWEWNLTIKKDWKD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.7 |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001172007 |
Locus ID | 396 |
UniProt ID | P52565 |
Cytogenetics | 17q25.3 |
Refseq ORF | 480 |
Synonyms | GDIA1; HEL-S-47e; NPHS8; RHOGDI; RHOGDI-1 |
Summary | This gene encodes a protein that plays a key role in the regulation of signaling through Rho GTPases. The encoded protein inhibits the disassociation of Rho family members from GDP (guanine diphosphate), thereby maintaining these factors in an inactive state. Activity of this protein is important in a variety of cellular processes, and expression of this gene may be altered in tumors. Mutations in this gene have been found in individuals with nephrotic syndrome, type 8. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
Protein Families | Druggable Genome |
Protein Pathways | Neurotrophin signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401371 | ARHGDIA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC434003 | ARHGDIA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401371 | Transient overexpression lysate of Rho GDP dissociation inhibitor (GDI) alpha (ARHGDIA) |
USD 436.00 |
|
LY434003 | Transient overexpression lysate of Rho GDP dissociation inhibitor (GDI) alpha (ARHGDIA), transcript variant 3 |
USD 436.00 |
|
PH300902 | ARHGDIA MS Standard C13 and N15-labeled recombinant protein (NP_004300) |
USD 3,255.00 |
|
TP300902 | Recombinant protein of human Rho GDP dissociation inhibitor (GDI) alpha (ARHGDIA), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review