TIMM8B (NM_012459) Human Recombinant Protein

CAT#: TP329090

Recombinant protein of human translocase of inner mitochondrial membrane 8 homolog B (yeast) (TIMM8B), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified TIMM8B protein (Cat# TP329090). The protein was produced from HEK293T cells transfected with TIMM8B cDNA clone (Cat# RC229090) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC229090 representing NM_012459
  Red=Cloning site Green=Tags(s)
  
  MRKHSCRKVASLRRTMAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENC
  LSSCVDRFIDTTLAITSRFAQIVQKGGQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_036591
• Locus ID: 26521
• UniProt ID: Q9Y5J9, G3XAN8
• Cytogenetics: 11q23.1
• Refseq ORF: 294
• Synonyms: DDP2; TIM8B
• Summary: This gene encodes a member of a well-conserved family of proteins with similarity to yeast Tim mitochondrial import proteins. This gene is encoded by a nuclear gene and is transported into the intermembrane space of the mitochondrion. When formed into complexes, these proteins guide membrane-spanning proteins across the mitochondrial intermembrane space before they are added into the mitochondrial inner membrane. This gene is adjacent to succinate dehydrogenase, subunit D (SDHD), in which mutations have been found in affected members of families with hereditary paraganglioma.[provided by RefSeq, Aug 2009]