SMAD6 (NM_001142861) Human Recombinant Protein

CAT#: TP327610

Recombinant protein of human SMAD family member 6 (SMAD6), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified SMAD6 protein (Cat# TP327610). The protein was produced from HEK293T cells transfected with SMAD6 cDNA clone (Cat# RC227610) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC227610 representing NM_001142861
  Red=Cloning site Green=Tags(s)
  
  MSRMGKPIETQKSPPPPYSRLSPRDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHW
  CSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTRSKIGFGILLSKEPDGVW
  AYNRGEHPIFVNSPTLDAPGGRALVVRKVPPGYSIKVFDFERSGLQHAPEPDAADGPYDPNSVRISFAKG
  WGPCYSRQFITSCPCWLEILLNNPR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 26.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001136333
• Locus ID: 4091
• UniProt ID: O43541
• Cytogenetics: 15q22.31
• Refseq ORF: 705
• Synonyms: AOVD2; HsT17432; MADH6; MADH7
• Summary: The protein encoded by this gene belongs to the SMAD family of proteins, which are related to Drosophila 'mothers against decapentaplegic' (Mad) and C. elegans Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions in the negative regulation of BMP and TGF-beta/activin-signalling. Multiple transcript variants have been found for this gene.[provided by RefSeq, Sep 2014]
• Protein Families: Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
• Protein Pathways: TGF-beta signaling pathway