SMAD6 (NM_001142861) Human Recombinant Protein
CAT#: TP327610
Recombinant protein of human SMAD family member 6 (SMAD6), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC227610 representing NM_001142861
Red=Cloning site Green=Tags(s) MSRMGKPIETQKSPPPPYSRLSPRDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHW CSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTRSKIGFGILLSKEPDGVW AYNRGEHPIFVNSPTLDAPGGRALVVRKVPPGYSIKVFDFERSGLQHAPEPDAADGPYDPNSVRISFAKG WGPCYSRQFITSCPCWLEILLNNPR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001136333 |
Locus ID | 4091 |
UniProt ID | O43541 |
Cytogenetics | 15q22.31 |
Refseq ORF | 705 |
Synonyms | AOVD2; HsT17432; MADH6; MADH7 |
Summary | The protein encoded by this gene belongs to the SMAD family of proteins, which are related to Drosophila 'mothers against decapentaplegic' (Mad) and C. elegans Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions in the negative regulation of BMP and TGF-beta/activin-signalling. Multiple transcript variants have been found for this gene.[provided by RefSeq, Sep 2014] |
Protein Families | Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors |
Protein Pathways | TGF-beta signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC428291 | SMAD6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY428291 | Transient overexpression lysate of SMAD family member 6 (SMAD6), transcript variant 2 |
USD 436.00 |
|
PH327610 | SMAD6 MS Standard C13 and N15-labeled recombinant protein (NP_001136333) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review