CHORDC1 (NM_001144073) Human Recombinant Protein
CAT#: TP327607
Recombinant protein of human cysteine and histidine-rich domain (CHORD)-containing 1 (CHORDC1), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC227607 representing NM_001144073
Red=Cloning site Green=Tags(s) MALLCYNRGCGQRFDPETNSDDACTYHPGVPVFHDALKGCTKGRHNSEKPPEPVKPEVKTTEKKELCELK PKFQEHIIQAPKPVEAIKRPSPDEPMTNLELKISASLKQALDKLKLSSGNEENKKEEDNDEIKIGTSCKN GGCSKTYQGLESLEEVCVYHSGVPIFHEGMKYWSCCRRKTSDFNTFLAQEGCTKGKHMWTKKDAGKKVVP CRHDWHQTGGEVTISVYAKNSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATK IEITMRKAEPMQWASLELPAAKKQEKQKDATTD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001137545 |
Locus ID | 26973 |
UniProt ID | Q9UHD1 |
Cytogenetics | 11q14.3 |
Refseq ORF | 939 |
Synonyms | CHP1 |
Summary | Regulates centrosome duplication, probably by inhibiting the kinase activity of ROCK2. Proposed to act as co-chaperone for HSP90. May play a role in the regulation of NOD1 via a HSP90 chaperone complex. In vitro, has intrinsic chaperone activity. This function may be achieved by inhibiting association of ROCK2 with NPM1. Involved in stress response. Prevents tumorigenesis.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC428496 | CHORDC1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY428496 | Transient overexpression lysate of cysteine and histidine-rich domain (CHORD)-containing 1 (CHORDC1), transcript variant 2 |
USD 436.00 |
|
PH327607 | CHORDC1 MS Standard C13 and N15-labeled recombinant protein (NP_001137545) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review