SIRPB1 (NM_001135844) Human Recombinant Protein

CAT#: TP326750

Purified recombinant protein of Homo sapiens signal-regulatory protein beta 1 (SIRPB1), transcript variant 3, 20 µg

Size: 20 ug 100 ug 1 mg


  View other "SIRPB1" proteins (7)

USD 867.00

4 Weeks*

Size
    • 20 ug

Product Images

Frequently bought together (2)
SIRPB1 mouse monoclonal antibody,clone OTI3G8
    • 100 ul

USD 447.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "SIRPB1"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC226750 representing NM_001135844
Red=Cloning site Green=Tags(s)

MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAAGESATLCCAMTSLIPVGPIMWFRG
AGAGRELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTE
LSVRAKPSAPVVSGPAVRATPEHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPAGDSVSYSIHS
TARVVLTRGDVHSQVICEMAHITLQGDPLRGTANLSEAIRVPPTLEVTQQPMRAENQANVTCQVSNFYPR
GLQLTWLENGNVSRTETASTLIENKDGTYNWMSWLLVNTCAHRDDVVLTCQVEHDGQQAVSKSYALEISA
HQKEHGSDITHEPALAPTAPLLVALLLGPKLLLVVGVSAIYICWKQKA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 41 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001129316
Locus ID 10326
UniProt ID Q5TFQ8
Cytogenetics 20p13
Refseq ORF 1194
Synonyms CD172b; SIRP-BETA-1
Summary The protein encoded by this gene is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. This protein was found to interact with TYROBP/DAP12, a protein bearing immunoreceptor tyrosine-based activation motifs. This protein was also reported to participate in the recruitment of tyrosine kinase SYK. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2009]
Protein Families Druggable Genome, Transmembrane

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.