CTPS2 (NM_001144002) Human Recombinant Protein
CAT#: TP326565
Recombinant protein of human CTP synthase II (CTPS2), transcript variant 3, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC226565 protein sequence
Red=Cloning site Green=Tags(s) MKYILVTGGVISGIGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLD LGNYERFLDINLYKDNNITTGKIYQHVINKERRGDYLGKTVQVVPHITDAVQEWVMNQAKVPVDGNKEEP QICVIELGGTIGDIEGMPFVEAFRQFQFKAKRENFCNIHVSLVPQLSATGEQKTKPTQNSVRALRGLGLS PDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSTYRVPVLLEEQSIVKYFKERLHLPIGDSASN LLFKWRNMADRYERLQKICSIALVGKYTKLRDCYASVFKALEHSALAINHKLNLMYIDSIDLEKITETED PVKFHEAWQKLCKADGILVPGGFGIRGTLGKLQAISWARTKKIPFLGVCLGMQLAVIEFARNCLNLKDAD STEFRPNAPVPLVIDMPEHNPGNLGGTMRLGIRRTVFKTENSILRKLYGDVPFIEERHRHRFEVNPNLIK QFEQNDLSFVGQDVDGDRMEIIELANHPYFVGVQFHPEFSSRPMKPSPPYLGLLLAATGNLNAYLQQGCK LSSSDRYSDASDDSFSEPRIAELEIS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 65.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001137474 |
Locus ID | 56474 |
UniProt ID | Q9NRF8, A0A024RC00 |
Cytogenetics | Xp22.2 |
Refseq Size | 4334 |
Refseq ORF | 1758 |
Synonyms | GATD5B |
Summary | The protein encoded by this gene catalyzes the formation of CTP from UTP with the concomitant deamination of glutamine to glutamate. This protein is the rate-limiting enzyme in the synthesis of cytosine nucleotides, which play an important role in various metabolic processes and provide the precursors necessary for the synthesis of RNA and DNA. Cancer cells that exhibit increased cell proliferation also exhibit an increased activity of this encoded protein. Thus, this protein is an attractive target for selective chemotherapy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
Protein Pathways | Metabolic pathways, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406236 | CTPS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC412688 | CTPS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428462 | CTPS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY406236 | Transient overexpression lysate of CTP synthase II (CTPS2), transcript variant 2 |
USD 436.00 |
|
LY412688 | Transient overexpression lysate of CTP synthase II (CTPS2), transcript variant 1 |
USD 436.00 |
|
LY428462 | Transient overexpression lysate of CTP synthase II (CTPS2), transcript variant 3 |
USD 436.00 |
|
PH305993 | CTPS2 MS Standard C13 and N15-labeled recombinant protein (NP_062831) |
USD 3,255.00 |
|
PH320566 | CTPS2 MS Standard C13 and N15-labeled recombinant protein (NP_787055) |
USD 3,255.00 |
|
PH326565 | CTPS2 MS Standard C13 and N15-labeled recombinant protein (NP_001137474) |
USD 3,255.00 |
|
TP305993 | Recombinant protein of human CTP synthase II (CTPS2), transcript variant 1, 20 µg |
USD 867.00 |
|
TP320566 | Recombinant protein of human CTP synthase II (CTPS2), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review