SH3BP2 (NM_001122681) Human Recombinant Protein
CAT#: TP325960
Recombinant protein of human SH3-domain binding protein 2 (SH3BP2), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225960 protein sequence
Red=Cloning site Green=Tags(s) MAAEEMHWPVPMKAIGAQNLLTMPGGVAKAGYLHKKGGTQLQLLKWPLRFVIIHKRCVYYFKSSTSASPQ GAFSLSGYNRVMRAAEETTSNNVFPFKIIHISKKHRTWFFSASSEEERKSWMALLRREIGHFHEKKDLPL DTSDSSSDTDSFYGAVERPVDISLSPYPTDNEDYEHDDEDDSYLEPDSPEPGRLEDALMHPPAYPPPPVP TPRKPAFSDMPRAHSFTSKGPGPLLPPPPPKHGLPDVGLAAEDSKRDPLCPRRAEPCPRVPATPRRMSDP PLSTMPTAPGLRKPPCFRESASPSPEPWTPGHGACSTSSAAIMATATSRNCDKLKSFHLSPRGPPTSEPP PVPANKPKFLKIAEEDPPREAAMPGLFVPPVAPRPPALKLPVPEAMARPAVLPRPEKPQLPHLQRSPPDG QSFRSFSFEKPRQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNS STKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHYHTHVLPSHQSLLLRHPYGYTGP R myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 62.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001116153 |
Locus ID | 6452 |
UniProt ID | P78314, A0A384N6E5 |
Cytogenetics | 4p16.3 |
Refseq Size | 9068 |
Refseq ORF | 1683 |
Synonyms | 3BP-2; 3BP2; CRBM; CRPM; RES4-23 |
Summary | The protein encoded by this gene has an N-terminal pleckstrin homology (PH) domain, an SH3-binding proline-rich region, and a C-terminal SH2 domain. The protein binds to the SH3 domains of several proteins including the ABL1 and SYK protein tyrosine kinases , and functions as a cytoplasmic adaptor protein to positively regulate transcriptional activity in T, natural killer (NK), and basophilic cells. Mutations in this gene result in cherubism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Natural killer cell mediated cytotoxicity |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401057 | SH3BP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC426549 | SH3BP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401057 | Transient overexpression lysate of SH3-domain binding protein 2 (SH3BP2), transcript variant 1 |
USD 436.00 |
|
LY426549 | Transient overexpression lysate of SH3-domain binding protein 2 (SH3BP2), transcript variant 2 |
USD 436.00 |
|
PH305759 | SH3BP2 MS Standard C13 and N15-labeled recombinant protein (NP_003014) |
USD 3,255.00 |
|
PH325960 | SH3BP2 MS Standard C13 and N15-labeled recombinant protein (NP_001116153) |
USD 3,255.00 |
|
TP305759 | Recombinant protein of human SH3-domain binding protein 2 (SH3BP2), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review