OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SYNPR (NM_001130003) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP325395
Purified recombinant protein of Homo sapiens synaptoporin (SYNPR), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA342623 Rabbit Polyclonal Anti-SYNPR Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "SYNPR or NM_001130003"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC225395 representing NM_001130003
Red=Cloning site Green=Tags(s)

MDPVSQLASAGTFRVLKEPLAFLRALELLFAIFAFATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFR
LHQVTFEVPTCEGKERQKLALIGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIV
TVVFSFLWLVGSSAWAKGLSDVKVATDPKEVLLLMSACKQPSNKCMAIHSPVMSSLNTSVVFGFLNFILW
AGNIWFVFKETGWHSSGQRYLSDPMEKHSSSYNQGGYNQDSYGSSSGYSQQASLGPTSDEFGQQPTGPTS
FTNQI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 31.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001123475
Locus ID 132204
UniProt ID Q8TBG9
Cytogenetics 3p14.2
RefSeq ORF 855
Synonyms SPO
Summary Intrinsic membrane protein of small synaptic vesicles. Probable vesicular channel protein (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Secreted Protein, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SYNPR" proteins (7)
SKU Description Size Price
PH305424 SYNPR MS Standard C13 and N15-labeled recombinant protein (NP_653243) 10 ug
$3,360.00
PH325395 SYNPR MS Standard C13 and N15-labeled recombinant protein (NP_001123475) 10 ug
$3,360.00
LC403401 Lyophilized SYNPR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427094 Lyophilized SYNPR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403401 Transient overexpression lysate of synaptoporin (SYNPR), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY427094 Transient overexpression lysate of synaptoporin (SYNPR), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP305424 Recombinant protein of human synaptoporin (SYNPR), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products