SYNPR (NM_001130003) Human Recombinant Protein
CAT#: TP325395
Purified recombinant protein of Homo sapiens synaptoporin (SYNPR), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225395 representing NM_001130003
Red=Cloning site Green=Tags(s) MDPVSQLASAGTFRVLKEPLAFLRALELLFAIFAFATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFR LHQVTFEVPTCEGKERQKLALIGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIV TVVFSFLWLVGSSAWAKGLSDVKVATDPKEVLLLMSACKQPSNKCMAIHSPVMSSLNTSVVFGFLNFILW AGNIWFVFKETGWHSSGQRYLSDPMEKHSSSYNQGGYNQDSYGSSSGYSQQASLGPTSDEFGQQPTGPTS FTNQI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001123475 |
Locus ID | 132204 |
UniProt ID | Q8TBG9 |
Cytogenetics | 3p14.2 |
Refseq ORF | 855 |
Synonyms | SPO |
Summary | Intrinsic membrane protein of small synaptic vesicles. Probable vesicular channel protein (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403401 | SYNPR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427094 | SYNPR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403401 | Transient overexpression lysate of synaptoporin (SYNPR), transcript variant 2 |
USD 436.00 |
|
LY427094 | Transient overexpression lysate of synaptoporin (SYNPR), transcript variant 1 |
USD 436.00 |
|
PH305424 | SYNPR MS Standard C13 and N15-labeled recombinant protein (NP_653243) |
USD 3,255.00 |
|
PH325395 | SYNPR MS Standard C13 and N15-labeled recombinant protein (NP_001123475) |
USD 3,255.00 |
|
TP305424 | Recombinant protein of human synaptoporin (SYNPR), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review