Legumain (LGMN) (NM_005606) Human Recombinant Protein
CAT#: TP324975
Recombinant protein of human legumain (LGMN), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224975 protein sequence
Red=Cloning site Green=Tags(s) MVWKVAVFLSVALGIGAIPIDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIVVMM YDDIAYSEDNPTPGIVINRPNGTDVYQGVPKDYTGEDVTPQNFLAVLRGDAEAVKGIGSGKVLKSGPQDH VFIYFTDHGSTGILVFPNEDLHVKDLNETIHYMYKHKMYRKMVFYIEACESGSMMNHLPDNINVYATTAA NPRESSYACYYDEKRSTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKTISTMKV MQFQGMKRKASSPVPLPPVTHLDLTPSPDVPLTIMKRKLMNTNDLEESRQLTEEIQRHLDARHLIEKSVR KIVSLLAASEAEVEQLLSERAPLTGHSCYPEALLHFRTHCFNWHSPTYEYALRHLYVLVNLCEKPYPLHR IKLSMDHVCLGHY SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 47.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005597 |
Locus ID | 5641 |
UniProt ID | Q99538, Q53XC6, Q96CY7 |
Cytogenetics | 14q32.12 |
Refseq Size | 2073 |
Refseq ORF | 1299 |
Synonyms | AEP; LGMN1; PRSC1 |
Summary | This gene encodes a cysteine protease that has a strict specificity for hydrolysis of asparaginyl bonds. This enzyme may be involved in the processing of bacterial peptides and endogenous proteins for MHC class II presentation in the lysosomal/endosomal systems. Enzyme activation is triggered by acidic pH and appears to be autocatalytic. Protein expression occurs after monocytes differentiate into dendritic cells. A fully mature, active enzyme is produced following lipopolysaccharide expression in mature dendritic cells. Overexpression of this gene may be associated with the majority of solid tumor types. This gene has a pseudogene on chromosome 13. Several alternatively spliced transcript variants have been described, but the biological validity of only two has been determined. These two variants encode the same isoform. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Antigen processing and presentation, Lysosome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400393 | LGMN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC417185 | LGMN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400393 | Transient overexpression lysate of legumain (LGMN), transcript variant 2 |
USD 436.00 |
|
LY417185 | Transient overexpression lysate of legumain (LGMN), transcript variant 1 |
USD 436.00 |
|
PH324975 | LGMN MS Standard C13 and N15-labeled recombinant protein (NP_005597) |
USD 3,255.00 |
|
TP720320 | Recombinant protein of human legumain (LGMN), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review