MPST (NM_001013440) Human Recombinant Protein
CAT#: TP324963
Recombinant protein of human mercaptopyruvate sulfurtransferase (MPST), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224963 protein sequence
Red=Cloning site Green=Tags(s) MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTS PYDHMLPGAEHFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAFGHHAVSLLDGGLRHWLRQNL PLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVN IPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWY MRARPEDVISEGRGKTH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.6 |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001013458 |
Locus ID | 4357 |
UniProt ID | P25325 |
Cytogenetics | 22q12.3 |
Refseq Size | 1626 |
Refseq ORF | 891 |
Synonyms | 3-mercaptopyruvate sulfurtransferase; human liver rhodanese; mercaptopyruvate sulfurtransferase; MGC24539; MST; MST, TST2, MGC24539; OTTHUMP00000028670; TST2 |
Summary | This protein encoded by this gene catalyzes the transfer of a sulfur ion from 3-mercaptopyruvate to cyanide or other thiol compounds. It may be involved in cysteine degradation and cyanide detoxification. There is confusion in literature between this protein (mercaptopyruvate sulfurtransferase, MPST), which appears to be cytoplasmic, and thiosulfate sulfurtransferase (rhodanese, TST, GeneID:7263), which is a mitochondrial protein. Deficiency in MPST activity has been implicated in a rare inheritable disorder known as mercaptolactate-cysteine disulfiduria (MCDU). Alternatively spliced transcript variants encoding same or different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Cysteine and methionine metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412074 | MPST HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422973 | MPST HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422977 | MPST HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427224 | MPST HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY412074 | Transient overexpression lysate of mercaptopyruvate sulfurtransferase (MPST), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 436.00 |
|
LY422973 | Transient overexpression lysate of mercaptopyruvate sulfurtransferase (MPST), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 436.00 |
|
LY422977 | Transient overexpression lysate of mercaptopyruvate sulfurtransferase (MPST), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 436.00 |
|
LY427224 | Transient overexpression lysate of mercaptopyruvate sulfurtransferase (MPST), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 436.00 |
|
PH302466 | MPST MS Standard C13 and N15-labeled recombinant protein (NP_001013454) |
USD 3,255.00 |
|
PH305101 | MPST MS Standard C13 and N15-labeled recombinant protein (NP_066949) |
USD 3,255.00 |
|
PH324963 | MPST MS Standard C13 and N15-labeled recombinant protein (NP_001013458) |
USD 3,255.00 |
|
PH325408 | MPST MS Standard C13 and N15-labeled recombinant protein (NP_001123989) |
USD 3,255.00 |
|
TP302466 | Recombinant protein of human mercaptopyruvate sulfurtransferase (MPST), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg |
USD 867.00 |
|
TP305101 | Recombinant protein of human mercaptopyruvate sulfurtransferase (MPST), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
USD 867.00 |
|
TP325408 | Recombinant protein of human mercaptopyruvate sulfurtransferase (MPST), nuclear gene encoding mitochondrial protein, transcript variant 3, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review