BLOC1S1 (NM_001487) Human Recombinant Protein

CAT#: TP324412

Recombinant protein of human biogenesis of lysosomal organelles complex-1, subunit 1 (BLOC1S1), 20 µg

Product Images

Coomassie blue staining of purified BLOC1S1 protein (Cat# TP324412). The protein was produced from HEK293T cells transfected with BLOC1S1 cDNA clone (Cat# RC224412) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC224412 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQF
  AKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001478
• Locus ID: 2647
• UniProt ID: P78537
• Cytogenetics: 12q13.2
• Refseq Size: 590
• Refseq ORF: 375
• Synonyms: BLOS1; BORCS1; GCN5L1; MICoA; RT14
• Summary: BLOC1S1 is a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules (Starcevic and Dell'Angelica, 2004 [PubMed 15102850]).[supplied by OMIM, Mar 2008]