Olfactory receptor 13C8 (OR13C8) (NM_001004483) Human Recombinant Protein
CAT#: TP323507
Recombinant protein of human olfactory receptor, family 13, subfamily C, member 8 (OR13C8), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223507 representing NM_001004483
Red=Cloning site Green=Tags(s) MERTNDSTSTEFFLVGLSAHPKLQTVFFVLILWMYLMILLGNGVLISVIIFDSHLHTPMYFFLCNLSFLD VCYTSSSVPLILASFLAVKKKVSFSGCMVQMFISFAMGATECMILGTMALDRYVAICYPLRYPVIMSKGA YVAMAAGSWVTGLVDSVVQTAFAMQLPFCANNVIKHFVCEILAILKLACADISINVISMTGSNLIVLVIP LLVISISYIFIVATILRIPSTEGKHKAFSTCSAHLTVVIIFYGTIFFMYAKPESKASVDSGNEDIIEALI SLFYGVMTPMLNPLIYSLRNKDVKAAVKNILCRKNFSDGK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001004483 |
Locus ID | 138802 |
UniProt ID | Q8NGS7, A0A126GVC7 |
Cytogenetics | 9q31.1 |
Refseq Size | 963 |
Refseq ORF | 960 |
Synonyms | OR9-10; OR37H |
Summary | Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Protein Pathways | Olfactory transduction |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423786 | OR13C8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY423786 | Transient overexpression lysate of olfactory receptor, family 13, subfamily C, member 8 (OR13C8) |
USD 436.00 |
|
PH323507 | OR13C8 MS Standard C13 and N15-labeled recombinant protein (NP_001004483) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review