Keratinocyte differentiation associated protein (KRTDAP) (NM_207392) Human Recombinant Protein

CAT#: TP323306

Recombinant protein of human keratinocyte differentiation-associated protein (KRTDAP), 20 µg

Product Images

Coomassie blue staining of purified KRTDAP protein (Cat# TP323306). The protein was produced from HEK293T cells transfected with KRTDAP cDNA clone (Cat# RC223306) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC223306 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKIPVLPAVVLLSLLVLHSAQGATLGGPEEESTIENYASRPEAFNTPFLNIDKLRSAFKADEFLNWHALF
  ESIKRKLPFLNWDAFPKLKGLRSATPDAQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_997275
• Locus ID: 388533
• UniProt ID: P60985
• Cytogenetics: 19q13.12
• Refseq Size: 500
• Refseq ORF: 297
• Synonyms: KDAP; UNQ467
• Summary: This gene encodes a protein which may function in the regulation of keratinocyte differentiation and maintenance of stratified epithelia. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]