C9ORF91 (TMEM268) (NM_153045) Human Recombinant Protein

CAT#: TP323282

Recombinant protein of human chromosome 9 open reading frame 91 (C9orf91), 20 µg

Product Images

Coomassie blue staining of purified TMEM268 protein (Cat# TP323282). The protein was produced from HEK293T cells transfected with TMEM268 cDNA clone (Cat# RC223282) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC223282 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MACEPQVDPGATGPLPPSSPGWSALPGGSPPGWGQELHNGQVLTVLRIDNTCAPISFDLGAAEEQLQTWG
  IQVPADQYRSLAESALLEPQVRRYIIYNSRPMRLAFAVVFYVVVWANIYSTSQMFALGNHWAGMLLVTLA
  AVSLTLTLVLVFERHQKKANTNTDLRLAAANGALLRHRVLLGVTDTVEGCQSVIQLWFVYFDLENCVQFL
  SDHVQEMKTSQESLLRSRLSQLCVVMETGVSPATAEGPENLEDAPLLPGNSCPNERPLMQTELHQLVPEA
  EPEEMARQLLAVFGGYYIRLLVTSQLPQAMGTRHTNSPRIPCPCQLIEAYILGTGCCPFLAR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 37.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_694590
• Locus ID: 203197
• UniProt ID: Q5VZI3
• Cytogenetics: 9q32
• Refseq Size: 4413
• Refseq ORF: 1026
• Synonyms: C9orf91
• Protein Families: Transmembrane