ASIP (NM_001672) Human Recombinant Protein

CAT#: TP322654

Recombinant protein of human agouti signaling protein, nonagouti homolog (mouse) (ASIP), 20 µg

Product Images

Coomassie blue staining of purified ASIP protein (Cat# TP322654). The protein was produced from HEK293T cells transfected with ASIP cDNA clone (Cat# RC222654) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC222654 representing NM_001672
  Red=Cloning site Green=Tags(s)
  
  MDVTRLLLATLLVFLCFFTANSHLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRKAAEKK
  RSSKKEASMKKVVRPRTPLSAPCVATRNSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001663
• Locus ID: 434
• UniProt ID: P42127
• Cytogenetics: 20q11.22
• Refseq Size: 584
• Refseq ORF: 396
• Synonyms: AGSW; AGTI; AGTIL; ASP; SHEP9
• Summary: In mice, the agouti gene encodes a paracrine signaling molecule that causes hair follicle melanocytes to synthesize pheomelanin, a yellow pigment, instead of the black or brown pigment, eumelanin. Pleiotropic effects of constitutive expression of the mouse gene include adult-onset obesity, increased tumor susceptibility, and premature infertility. This gene is highly similar to the mouse gene and encodes a secreted protein that may (1) affect the quality of hair pigmentation, (2) act as a pharmacological antagonist of alpha-melanocyte-stimulating hormone, (3) play a role in neuroendocrine aspects of melanocortin action, and (4) have a functional role in regulating lipid metabolism in adipocytes. [provided by RefSeq, Jul 2008]
• Protein Families: Secreted Protein
• Protein Pathways: Melanogenesis