ASIP (NM_001672) Human Recombinant Protein
CAT#: TP322654
Recombinant protein of human agouti signaling protein, nonagouti homolog (mouse) (ASIP), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222654 representing NM_001672
Red=Cloning site Green=Tags(s) MDVTRLLLATLLVFLCFFTANSHLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRKAAEKK RSSKKEASMKKVVRPRTPLSAPCVATRNSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001663 |
Locus ID | 434 |
UniProt ID | P42127 |
Cytogenetics | 20q11.22 |
Refseq Size | 584 |
Refseq ORF | 396 |
Synonyms | AGSW; AGTI; AGTIL; ASP; SHEP9 |
Summary | In mice, the agouti gene encodes a paracrine signaling molecule that causes hair follicle melanocytes to synthesize pheomelanin, a yellow pigment, instead of the black or brown pigment, eumelanin. Pleiotropic effects of constitutive expression of the mouse gene include adult-onset obesity, increased tumor susceptibility, and premature infertility. This gene is highly similar to the mouse gene and encodes a secreted protein that may (1) affect the quality of hair pigmentation, (2) act as a pharmacological antagonist of alpha-melanocyte-stimulating hormone, (3) play a role in neuroendocrine aspects of melanocortin action, and (4) have a functional role in regulating lipid metabolism in adipocytes. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Protein Pathways | Melanogenesis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419812 | ASIP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419812 | Transient overexpression lysate of agouti signaling protein, nonagouti homolog (mouse) (ASIP) |
USD 436.00 |
|
PH322654 | ASIP MS Standard C13 and N15-labeled recombinant protein (NP_001663) |
USD 3,255.00 |
|
TP701037 | Purified recombinant protein of Human agouti signaling protein (ASIP), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review