BMX (NM_001721) Human Recombinant Protein
CAT#: TP321915
Recombinant protein of human BMX non-receptor tyrosine kinase (BMX), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221915 representing NM_001721
Red=Cloning site Green=Tags(s) MDTKSILEELLLKRSQQKKKMSPNNYKERLFVLTKTNLSYYEYDKMKRGSRKGSIEIKKIRCVEKVNLEE QTPVERQYPFQIVYKDGLLYVYASNEESRSQWLKALQKEIRGNPHLLVKYHSGFFVDGKFLCCQQSCKAA PGCTLWEAYANLHTAVNEEKHRVPTFPDRVLKIPRAVPVLKMDAPSSSTTLAQYDNESKKNYGSQPPSSS TSLAQYDSNSKKIYGSQPNFNMQYIPREDFPDWWQVRKLKSSSSSEDVASSNQKERNVNHTTSKISWEFP ESSSSEEEENLDDYDWFAGNISRSQSEQLLRQKGKEGAFMVRNSSQVGMYTVSLFSKAVNDKKGTVKHYH VHTNAENKLYLAENYCFDSIPKLIHYHQHNSAGMITRLRHPVSTKANKVPDSVSLGNGIWELKREEITLL KELGSGQFGVVQLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKEYPIYIVTE YISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDRDLCVKVSDFGMTRY VLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSQVVLKVSQGHR LYRPHLASDTIYQIMYSCWHELPEKRPTFQQLLSSIEPLREKDKH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 77.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Bioactivity | BMX activity verified in a biochemical assay: BMX (BMX non-receptor tyrosine kinase) (TP321915) activity was measured in a homogeneous time-resolved fluorescent (HTRF®) assay. BMX is a non-receptor tyrosine kinase belonging to the Tec kinase family. BMX has been implicated in the Stat pathway and reportedly regulates differentiation and tumorigenicity of several types of cancer cells. Varying concentrations of BMX were added to a reaction mix containing ATP and a biotinylated kinase substrate and the reaction mixture was incubated to allow the protein to phosphorylate the substrate. HTRF detection reagents were then added, and the time-resolved fluorescent signal was measured on a Flexstation 3 microplate reader. The time resolved fluorescent signal is expressed as “delta R” or “ΔR” and is a ratio calculated from the fluorescent emission intensities of the donor and acceptor fluors. |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001712 |
Locus ID | 660 |
UniProt ID | P51813 |
Cytogenetics | Xp22.2 |
Refseq Size | 2514 |
Refseq ORF | 2025 |
Synonyms | ETK; PSCTK2; PSCTK3 |
Summary | This gene encodes a non-receptor tyrosine kinase belonging to the Tec kinase family. The protein contains a PH-like domain, which mediates membrane targeting by binding to phosphatidylinositol 3,4,5-triphosphate (PIP3), and a SH2 domain that binds to tyrosine-phosphorylated proteins and functions in signal transduction. The protein is implicated in several signal transduction pathways including the Stat pathway, and regulates differentiation and tumorigenicity of several types of cancer cells. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2016] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400648 | BMX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC404365 | BMX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400648 | Transient overexpression lysate of BMX non-receptor tyrosine kinase (BMX), transcript variant 2 |
USD 436.00 |
|
LY404365 | Transient overexpression lysate of BMX non-receptor tyrosine kinase (BMX), transcript variant 1 |
USD 436.00 |
|
PH302002 | BMX MS Standard C13 and N15-labeled recombinant protein (NP_975010) |
USD 3,255.00 |
|
PH321915 | BMX MS Standard C13 and N15-labeled recombinant protein (NP_001712) |
USD 3,255.00 |
|
TP302002 | Recombinant protein of human BMX non-receptor tyrosine kinase (BMX), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review