FUSIP1 (SRSF10) (NM_006625) Human Recombinant Protein

CAT#: TP321759

Recombinant protein of human FUS interacting protein (serine/arginine-rich) 1 (FUSIP1), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified SRSF10 protein (Cat# TP321759). The protein was produced from HEK293T cells transfected with SRSF10 cDNA clone (Cat# RC221759) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC221759 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHN
  LDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRR
  SYSPRNSRPTGRPRRSRSHSDNDRPNCSWNTQYSSAYYTSRKI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006616
• Locus ID: 10772
• UniProt ID: O75494
• Cytogenetics: 1p36.11
• Refseq Size: 4076
• Refseq ORF: 549
• Synonyms: FUSIP1; FUSIP2; NSSR; PPP1R149; SFRS13; SFRS13A; SRp38; SRrp40; TASR; TASR1; TASR2
• Summary: This gene product is a member of the serine-arginine (SR) family of proteins, which are involved in constitutive and regulated RNA splicing. Members of this family are characterized by N-terminal RNP1 and RNP2 motifs, which are required for binding to RNA, and multiple C-terminal SR/RS repeats, which are important in mediating association with other cellular proteins. This protein interacts with the oncoprotein TLS, and abrogates the influence of TLS on adenovirus E1A pre-mRNA splicing. This gene has pseudogenes on chromosomes 4, 9, 14, 18, and 20. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
• Protein Families: Transcription Factors
• Protein Pathways: Spliceosome