ZFAND5 (NM_001102420) Human Recombinant Protein
CAT#: TP321072
Recombinant protein of human zinc finger, AN1-type domain 5 (ZFAND5), transcript variant a, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221072 protein sequence
Red=Cloning site Green=Tags(s) MAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPTSDSASVQRAD TSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSE EKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKAEAAAKIRKENPVVVAEKI QRI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001095890 |
Locus ID | 7763 |
UniProt ID | O76080, A0A024R219 |
Cytogenetics | 9q21.13 |
Refseq Size | 5887 |
Refseq ORF | 639 |
Synonyms | ZA20D2; ZFAND5A; ZNF216 |
Summary | Involved in protein degradation via the ubiquitin-proteasome system. May act by anchoring ubiquitinated proteins to the proteasome. Plays a role in ubiquitin-mediated protein degradation during muscle atrophy. Plays a role in the regulation of NF-kappa-B activation and apoptosis. Inhibits NF-kappa-B activation triggered by overexpression of RIPK1 and TRAF6 but not of RELA. Inhibits also tumor necrosis factor (TNF), IL-1 and TLR4-induced NF-kappa-B activation in a dose-dependent manner. Overexpression sensitizes cells to TNF-induced apoptosis. Is a potent inhibitory factor for osteoclast differentiation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416931 | ZFAND5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC420147 | ZFAND5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC420148 | ZFAND5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY416931 | Transient overexpression lysate of zinc finger, AN1-type domain 5 (ZFAND5), transcript variant c |
USD 436.00 |
|
LY420147 | Transient overexpression lysate of zinc finger, AN1-type domain 5 (ZFAND5), transcript variant a |
USD 436.00 |
|
LY420148 | Transient overexpression lysate of zinc finger, AN1-type domain 5 (ZFAND5), transcript variant b |
USD 436.00 |
|
PH309943 | ZFAND5 MS Standard C13 and N15-labeled recombinant protein (NP_005998) |
USD 3,255.00 |
|
PH321072 | ZFAND5 MS Standard C13 and N15-labeled recombinant protein (NP_001095890) |
USD 3,255.00 |
|
PH321129 | ZFAND5 MS Standard C13 and N15-labeled recombinant protein (NP_001095891) |
USD 3,255.00 |
|
TP309943 | Recombinant protein of human zinc finger, AN1-type domain 5 (ZFAND5), transcript variant c, 20 µg |
USD 867.00 |
|
TP321129 | Recombinant protein of human zinc finger, AN1-type domain 5 (ZFAND5), transcript variant b, 20 µg |
USD 867.00 |
|
TP710147 | Recombinant protein of human zinc finger, AN1-type domain 5 (ZFAND5), transcript variant c, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 515.00 |
{0} Product Review(s)
Be the first one to submit a review